| Cat.No.: | EAb-3260 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EZH2 |
| Immunogen Sequence: | MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQ |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 105kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | HL-60,SW620 |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q15910; NP_001190176.1; Gene ID 2146 |
| Alternative Name: | EZH2; ENX-1; ENX1; EZH1; EZH2b; KMT6; KMT6A; WVS; WVS2; histone-lysine N-methyltransferase EZH2 |
| Scientific Background: | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0006 | GSK343 | Inquiry |
| BSM-0059 | 3-Deazaneplanocin A | Inquiry |
| BSM-0060 | 3-Deazaneplanocin A hydrochloride | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0024 | Recombinant Human EZH1 293 Cell Lysate | Inquiry |
| EL-0025 | Recombinant Human EZH2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| ezh1 | EZH2 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.