ASF1B Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3250
Product Overview:  Rabbit polyclonal to detect ASF1b
Antibody Type:  Polyclonal
Immunogen:  Recombinant full length protein corresponding to Human ASF1b aa 1-202.
Immunogen Sequence:  MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAES EEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCT YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMD CI
Host:  Rabbit
Isotype:  IgG
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  pH: 7.40; 0.03% Proclin, PBS, 50% Glycerol
Applications:  WB, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NVP2
Alternative Name:  Anti silencing function 1B antibody/Anti silencing function 1B histone chaperone antibody/Anti-silencing function protein 1 homolog B antibody
Scientific Background:  Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for spermatogenesis.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.