| Cat.No.: | EAb-3250 |
| Product Name: | ASF1B Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect ASF1b |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant full length protein corresponding to Human ASF1b aa 1-202. |
| Immunogen Sequence: | MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAES EEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCT YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMD CI |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein G purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.40; 0.03% Proclin, PBS, 50% Glycerol |
| Applications: | WB, IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9NVP2 |
| Alternative Name: | Anti silencing function 1B antibody/Anti silencing function 1B histone chaperone antibody/Anti-silencing function protein 1 homolog B antibody |
| Scientific Background: | Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for spermatogenesis. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0018 | Human ASH1L Knockout Cell Line 53bp deletion | Inquiry |
| CL-0019 | Human ASXL2 Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0162 | Recombinant Human ASH2L 293 Cell Lysate | Inquiry |
| EL-0173 | Recombinant Human ASF1A 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0168 | ASH2 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| ASB10 | ASB11 | ASB13 | ASB6 |
| ASB7 | ASB8 | ASB9 | ASF1 |
| ASH1L | ASH2 | ASXL2 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools