Spt6 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3247
Product Name:  Spt6 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect Spt6
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human Spt6 aa 1322-1419.
Immunogen Sequence:  RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTW KVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  IHC-P, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q7KZ85
Alternative Name:  emb 5 antibody/hSPT6 antibody/KIAA0162 antibody
Scientific Background:  Acts to stimulate transcriptional elongation by RNA polymerase II.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.