CDKA1/DOC1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3201
Product Overview:  Rabbit polyclonal to detect CDKA1/DOC1
Antibody Type:  Polyclonal
Immunogen:  Recombinant full length protein corresponding to Human CDKA1/ DOC1 aa 1-115.
Immunogen Sequence:  MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYT QGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARG LVRECLAETERNARS
Host:  Rabbit
Isotype:  IgG
Purification:  Caprylic Acid - Ammonium Sulfate precipitation
Appearance:  Liquid
Formulation:  pH: 7.4; 0.03% Proclin, 49% PBS, 50% Glycerol
Applications:  IHC-P, WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O14519; NP_004633.1
Alternative Name:  CDK2 A1 antibody/CDK2 associated protein 1 antibody/CDK2-associated protein 1 antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart