CDKA1/DOC1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3173
Product Overview:  Rabbit polyclonal to detect CDKA1/DOC1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human CDKA1/ DOC1 aa 1-30.
Immunogen Sequence:  MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O14519-1
Alternative Name:  CDK2 A1 antibody/CDK2 associated protein 1 antibody/CDK2-associated protein 1 antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.