TET1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3172
Product Overview:  Rabbit polyclonal to detect TET1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human TET1 aa 82-205.
Immunogen Sequence:  MNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPLVVAKSKKVPLS KGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSLL KGKSQETTQFWSQRVEDSKINIPT
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 40% Glycerol, 59% PBS
Applications:  ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q8NFU7
Alternative Name:  bA119F7.1 antibody/CXXC 6 antibody/CXXC finger 6 antibody
Scientific Background:  Dioxygenase that catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). Plays a role in embryonic stem (ES) cell maintenance and inner cell mass (ICM) cell specification, possibly by participating in DNA demethylation. Specifically binds 5mC, a minor base in mammalian DNA found in repetitive DNA elements that is crucial for retrotransposon silencing and mammalian development. 5mC is present in ES cells and is enriched in the brain, especially in Purkinje neurons. The clear function of hmC is still unclear but it could constitute an intermediate component in cytosine demethylation. A role of hmC in DNA demethylation is supported by TET1 function in ES cell maintenance, which is required to prevent NANOG hypermethylation and maintain NANOG expression in ES cells.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.