| Cat.No.: | EAb-3172 |
| Product Overview: | Rabbit polyclonal to detect TET1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human TET1 aa 82-205. |
| Immunogen Sequence: | MNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPLVVAKSKKVPLS KGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSLL KGKSQETTQFWSQRVEDSKINIPT |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.2; 0.02% Sodium azide, 40% Glycerol, 59% PBS |
| Applications: | ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q8NFU7 |
| Alternative Name: | bA119F7.1 antibody/CXXC 6 antibody/CXXC finger 6 antibody |
| Scientific Background: | Dioxygenase that catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). Plays a role in embryonic stem (ES) cell maintenance and inner cell mass (ICM) cell specification, possibly by participating in DNA demethylation. Specifically binds 5mC, a minor base in mammalian DNA found in repetitive DNA elements that is crucial for retrotransposon silencing and mammalian development. 5mC is present in ES cells and is enriched in the brain, especially in Purkinje neurons. The clear function of hmC is still unclear but it could constitute an intermediate component in cytosine demethylation. A role of hmC in DNA demethylation is supported by TET1 function in ES cell maintenance, which is required to prevent NANOG hypermethylation and maintain NANOG expression in ES cells. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0154 | Recombinant Human TET3 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0176 | TEAD2 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0215 | Human TET1 Knockout Cell Line 1bp insertion | Inquiry |
| CL-0217 | Human TET2 Knockout Cell Line 19bp deletion | Inquiry |
| CL-0218 | Human TET3 Knockout Cell Line 14bp deletion | Inquiry |
| Related Gene / Proteins | |||
| TEAD1 | TEAD2 | telomerase | TEN1 |
| TENR | TERF2IP | TET | TET1 |
| TET2 | TET3 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.