ZBTB38 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3171
Product Overview:  Rabbit polyclonal to detect ZBTB38
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human ZBTB38 aa 692-817.
Immunogen Sequence:  PVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNH RAFSDPAVSQSLKDDSKPEPDKVGRFASRPKSIKEKKKTTSHTRGEIPEE SNYVADPGGSLSKTTNIAEETSKIET
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q8NAP3
Alternative Name:  CIBZ antibody/FLJ22332 antibody/FLJ31131 antibody
Scientific Background:  Acts as a transcriptional activator. May be involved in the differentiation and/or survival of late postmitotic neurons.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart