SRY/TDF Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3115
Product Name:  SRY/TDF Polyclonal Antibody
Product Overview:  Mouse polyclonal to detect SRY/TDF
Antibody Type:  Polyclonal
Immunogen:  Full length protein corresponding to Human SRY/TDF aa 1-204.
Immunogen Sequence:  MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGE NSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKM LTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPA SVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSH WTKL
Host:  Mouse
Isotype:  IgG
Purification:  Protein A purified
Appearance:  Liquid
Formulation:  pH: 7.20, 99% PBS
Applications:  WB, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  NP_003131.1
Alternative Name:  Essential protein for sex determination in human males antibody/Sex determining region on Y antibody/Sex determining region protein antibody
Scientific Background:  Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (By similarity). In male adult brain involved in the maintenance of motor functions of dopaminergic neurons (By similarity). Involved in different aspects of gene regulation including promoter activation or repression (By similarity). Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.