| Cat.No.: | EAb-3112 |
| Product Name: | SRY/TDF Monoclonal Antibody (OTI3C8) |
| Product Overview: | Mouse monoclonal (OTI3C8) to detect SRY/TDF |
| Antibody Type: | Monoclonal |
| Clone Designation: | OTI3C8 |
| Immunogen: | Recombinant full length protein corresponding to Human SRY/TDF aa 1-204. |
| Immunogen Sequence: | MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGE NSKGNVQDRVKRPMNAFIVW |
| Host: | Mouse |
| Isotype: | IgG1 |
| Purification: | Affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.30; 0.02% Sodium azide, 50% Glycerol, 1% BSA, PBS |
| Applications: | WB, ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Alternative Name: | Essential protein for sex determination in human males antibody/Sex determining region on Y antibody/Sex determining region protein antibody |
| Scientific Background: | Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (By similarity). In male adult brain involved in the maintenance of motor functions of dopaminergic neurons (By similarity). Involved in different aspects of gene regulation including promoter activation or repression (By similarity). Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0016 | TDRD4 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0049 | Recombinant Human TDRD3 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0285 | Human TDG Knockout Cell Line 2bp insertion | Inquiry |
| CL-0286 | Human TDGF1 Knockout Cell Line | Inquiry |
| ◆ Research Kits | ||
| EKIT-0422 | SREBP-2 Transcription Factor Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| SRBD1 | SRC1 | SREBP | SREBP-1 |
| SREBP-2 | SRF | SRP14 | SRP19 |
| SRY | TDF | TDG | TDGF1 |
| TDP1 | TDRD12 | TDRD3 | TDRD4 |
| TDRD4 | TDT | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools