| Cat.No.: | EAb-3098 |
| Product Overview: | Rabbit polyclonal to detect HMGN5 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human HMGN5 aa 23-124. |
| Immunogen Sequence: | LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVV EEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAE VK |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | ICC/IF, IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P82970 |
| Alternative Name: | High mobility group nucleosome binding domain 5 antibody/High mobility group nucleosome-binding domain-containing protein 5 antibody/Hmgn5 antibody |
| Scientific Background: | Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
