HMGN5 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3098
Product Overview:  Rabbit polyclonal to detect HMGN5
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human HMGN5 aa 23-124.
Immunogen Sequence:  LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVV EEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAE VK
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  ICC/IF, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P82970
Alternative Name:  High mobility group nucleosome binding domain 5 antibody/High mobility group nucleosome-binding domain-containing protein 5 antibody/Hmgn5 antibody
Scientific Background:  Preferentially binds to euchromatin and modulates cellular transcription by counteracting linker histone-mediated chromatin compaction.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.