Histone H1t2 Polyclonal Antibody (N-terminal)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3095
Product Overview:  Rabbit polyclonal to detect Histone H1t2 - N-terminal
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human Histone H1t2 aa 1-94 (N terminal).
Immunogen Sequence:  MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPS RGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 59% PBS, 40% Glycerol
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q75WM6
Alternative Name:  H1 histone family member N testis specific antibody/H1FNT antibody/H1FNT_HUMAN antibody
Scientific Background:  Essential for normal spermatogenesis and male fertility. Required for proper cell restructuring and DNA condensation during the elongation phase of spermiogenesis. Involved in the histone-protamine transition of sperm chromatin and the subsequent production of functional sperm. Binds both double-stranded and single-stranded DNA, ATP and protamine-1.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart