KDM4E Polyclonal Antibody (N-terminal)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2999
Product Name:  KDM4E Polyclonal Antibody (N-terminal)
Product Overview:  Rabbit polyclonal to detect KDM4E - N-terminal
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human KDM4E aa 60-109 (N terminal).
Immunogen Sequence:  YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 2% Sucrose, PBS
Applications:  WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  B2RXH2; NP_001155102
Alternative Name:  JMJD2E antibody/KDM4D-like protein antibody/KDM4DL antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.