Cat.No.: | EAb-2999 |
Product Name: | KDM4E Polyclonal Antibody (N-terminal) |
Product Overview: | Rabbit polyclonal to detect KDM4E - N-terminal |
Antibody Type: | Polyclonal |
Immunogen: | Synthetic peptide within Human KDM4E aa 60-109 (N terminal). |
Immunogen Sequence: | YDDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQT |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | 0.09% Sodium azide, 2% Sucrose, PBS |
Applications: | WB |
Species Reactivity: | Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | B2RXH2; NP_001155102 |
Alternative Name: | JMJD2E antibody/KDM4D-like protein antibody/KDM4DL antibody |
Product Types | ||
◆ Cell Lines | ||
CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
KDM1 | KDM1A | KDM1B | KDM2 |
KDM2A | KDM2B | KDM3A | KDM3B |
KDM4 | KDM4A | KDM4B | KDM4C |
KDM4D | KDM4E | KDM5 | KDM5A |
KDM5B | KDM5C | KDM5D | KDM6A More > |
KDM6B | KDM6C | KDM7 | KDM7A |
KDM7B | KDM8 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools