| Cat.No.: | EAb-2998 |
| Product Overview: | Rabbit polyclonal to detect KMT3B/NSD1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human KMT3B/ NSD1 aa 806-936. |
| Immunogen Sequence: | INEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETA VVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDY KFSTLLMMLKDMHDSKTKEQRLMTAQNLVSY |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q96L73 |
| Alternative Name: | Androgen receptor coactivator 267 kDa protein antibody/Androgen receptor-associated protein of 267 kDa antibody/ARA267 antibody |
| Scientific Background: | Histone methyltransferase. Preferentially methylates 'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro). Transcriptional intermediary factor capable of both negatively or positively influencing transcription, depending on the cellular context. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0113 | Human NSD1 Knockout Cell Line 4bp deletion | Inquiry |
| CL-0216 | Human KMT2A Knockout Cell Line 32bp deletion | Inquiry |
| CL-0475 | Human KMT2A Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0172 | Human KMT2C / MLL3 peptide | Inquiry |
| ◆ Research Kits | ||
| EKIT-0287 | NSD1 Chemiluminescent Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| nsd1 | NSD2 | NSD3 | NSMCE2 |
| NSUN1 | NSUN2 | NSUN3 | NSUN4 More > |
| NSUN5 | NSUN6 | NSUN7 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.