KMT3B/NSD1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2998
Product Overview:  Rabbit polyclonal to detect KMT3B/NSD1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human KMT3B/ NSD1 aa 806-936.
Immunogen Sequence:  INEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETA VVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHIPIEPDY KFSTLLMMLKDMHDSKTKEQRLMTAQNLVSY
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q96L73
Alternative Name:  Androgen receptor coactivator 267 kDa protein antibody/Androgen receptor-associated protein of 267 kDa antibody/ARA267 antibody
Scientific Background:  Histone methyltransferase. Preferentially methylates 'Lys-36' of histone H3 and 'Lys-20' of histone H4 (in vitro). Transcriptional intermediary factor capable of both negatively or positively influencing transcription, depending on the cellular context.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart