| Cat.No.: | EAb-2990 |
| Product Overview: | Rabbit polyclonal to detect TRIM5 alpha |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human TRIM5 alpha aa 163-231. |
| Immunogen Sequence: | IREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILK SLTNSETEMVQQTQSLREL |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9C035 |
| Alternative Name: | RING finger protein 88 antibody/RNF88 antibody/TRIM5 antibody |
| Scientific Background: | Isoform Alpha is a retrovirus restriction factor, which mediates species-specific, early block to retrovirus infection. Targets retroviral capsid soon after entry into the cell, and prevents reverse transcription of the virus RNA genome. Isoform Alpha trimers may make multiple contacts with the hexameric lattice of CA proteins which constitute the surface of retrovirion core, and somehow inactivate the virus. Restricts efficiently infection by N-MLV, but not HIV-1. May have E3 ubiquitin-protein ligase activity. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0018 | Danusertib (PHA-739358) | Inquiry |
| BSM-0021 | PF-03814735 | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0107 | Recombinant Human TRIM68 293 Cell Lysate | Inquiry |
| EL-0109 | Recombinant Human TRIP4 Lysate | Inquiry |
| EL-0115 | Recombinant Human TRIM24 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| TRA2A | TRAF4 | TRAF5 | TRAF6 |
| TRAK2 | TRBP | TRDMT1 | TREX1 |
| TRF2 | TRIM11 | TRIM13 | TRIM16 |
| TRIM17 | TRIM2 | TRIM21 | trim24 |
| TRIM26 | TRIM28 | TRIM3 | TRIM33 More > |
| TRIM34 | TRIM35 | TRIM36 | TRIM37 |
| TRIM38 | TRIM39 | TRIM4 | TRIM5 |
| TRIM55 | TRIM6 | TRIM63 | TRIM66 |
| TRIM68 | TRIM8 | TRIM9 | TRIML1 |
| TRIP4 | Tristetraprolin | TRIT1 | TrkA |
| TRMT2A | TRMT44 | TRMT5 | TRMT6 |
| TROVE2 | TRUB2 | TRX1 | TRβ1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.