TRIM5 alpha Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2990
Product Overview:  Rabbit polyclonal to detect TRIM5 alpha
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human TRIM5 alpha aa 163-231.
Immunogen Sequence:  IREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILK SLTNSETEMVQQTQSLREL
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9C035
Alternative Name:  RING finger protein 88 antibody/RNF88 antibody/TRIM5 antibody
Scientific Background:  Isoform Alpha is a retrovirus restriction factor, which mediates species-specific, early block to retrovirus infection. Targets retroviral capsid soon after entry into the cell, and prevents reverse transcription of the virus RNA genome. Isoform Alpha trimers may make multiple contacts with the hexameric lattice of CA proteins which constitute the surface of retrovirion core, and somehow inactivate the virus. Restricts efficiently infection by N-MLV, but not HIV-1. May have E3 ubiquitin-protein ligase activity.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.