KDM5A/Jarid1A/RBBP2 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2982
Product Overview:  Rabbit polyclonal to detect KDM5A/Jarid1A/RBBP2
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human KDM5A/ Jarid1A/ RBBP2 aa 130-160 conjugated to keyhole limpet haemocyanin.
Immunogen Sequence:  FEMVTKEKKWSKVGSRLGYLPGKGTGSLLKS
Host:  Rabbit
Isotype:  IgG
Purification:  Protein A purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 50% Glycerol, 1% BSA, Aqueous buffered solution
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P29375
Alternative Name:  Histone demethylase JARID1A antibody/JARID1A antibody/Jumonji/ARID domain containing protein 1A antibody
Scientific Background:  Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.