| Cat.No.: | EAb-2982 |
| Product Overview: | Rabbit polyclonal to detect KDM5A/Jarid1A/RBBP2 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human KDM5A/ Jarid1A/ RBBP2 aa 130-160 conjugated to keyhole limpet haemocyanin. |
| Immunogen Sequence: | FEMVTKEKKWSKVGSRLGYLPGKGTGSLLKS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein A purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 50% Glycerol, 1% BSA, Aqueous buffered solution |
| Applications: | IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P29375 |
| Alternative Name: | Histone demethylase JARID1A antibody/JARID1A antibody/Jumonji/ARID domain containing protein 1A antibody |
| Scientific Background: | Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May stimulate transcription mediated by nuclear receptors. May be involved in transcriptional regulation of Hox proteins during cell differentiation. May participate in transcriptional repression of cytokines such as CXCL12. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0002 | AT9283 | Inquiry |
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| JADE1 | JAK | JAK1 | JAK2 |
| JAK3 | JAKMIP1 | JARID | JARID1 |
| JARID1A | JARID1B | JARID1C | JARID2 |
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B More > |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | RB1 | RbAp46 |
| RbAp48 | RBB4L | RBBP2 | RBBP4 |
| RBBP5 | RBBP7 | RBBP9 | RBM11 |
| RBM18 | RBM26 | RBM3 | RBM34 |
| RBM38 | RBM39 | RBM41 | RBM42 |
| RBM46 | RBM5 | RBM7 | RBMS1 |
| RBMS2 | RBMS3 | RBMY1A1 | RBMY1F |
| RBPJ | RBPMS | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.