HDAC10 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2958
Product Name:  HDAC10 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect HDAC10
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human HDAC10 aa 540-590 conjugated to keyhole limpet haemocyanin.
Immunogen Sequence:  SMFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPH A
Host:  Rabbit
Isotype:  IgG
Purification:  Protein A purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 1% BSA, 50% Glycerol
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q969S8
Alternative Name:  DKFZP761B039 antibody/HD 10 antibody/HD10 antibody
Scientific Background:  Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.