KDM4B/JMJD2B Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2945
Product Name:  KDM4B/JMJD2B Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect KDM4B/JMJD2B
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human KDM4B/ JMJD2B aa 1036-1090.
Immunogen Sequence:  SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESL LQVQG
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 59% PBS, 40% Glycerol
Applications:  ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O94953
Alternative Name:  JHDM3B antibody/JmjC domain-containing histone demethylation protein 3B antibody/JMJD2B antibody
Scientific Background:  Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9', with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.