KDM5B/PLU1/Jarid1B Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2934
Product Overview:  Rabbit polyclonal to detect KDM5B/PLU1/Jarid1B
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human KDM5B/ PLU1/ Jarid1B aa 1401-1481.
Immunogen Sequence:  DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFK LERERSYELVRSAETHSLPSDTSYSEQEDSE
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 40% Glycerol, 59% PBS
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9UGL1
Alternative Name:  Cancer/testis antigen 31 antibody/CT31 antibody/Histone demethylase JARID1B antibody
Scientific Background:  Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, may act as a tumor suppressor for melanoma.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart