HMGB1 Monoclonal Antibody (1F3)

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2869
Product Overview:  Mouse monoclonal (1F3) to detect HMGB1
Antibody Type:  Monoclonal
Clone Designation:  1F3
Immunogen:  Recombinant full length protein corresponding to Human HMGB1 aa 1-215. purified form E. coli.
Immunogen Sequence:  MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE EDEEDEDEEEDDDDE
Host:  Mouse
Isotype:  IgG2b
Purification:  Protein A purified
Appearance:  Liquid
Applications:  ICC/IF, WB, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P09429
Alternative Name:  Amphoterin antibody/Chromosomal protein, nonhistone, HMG1 antibody/DKFZp686A04236 antibody
Scientific Background:  High mobility group (HMG) proteins 1 and 2 are ubiquitous non-histone components of chromatin. Evidence suggests that the binding of HMG proteins to DNA induces alterations in the DNA architecture including DNA bending and unwinding of the helix. HMG proteins synergize with Oct-2, members of the NF˚B family, ATF-2 and c-Jun to activate transcription. Other studies indicate that phosphorylation of HMG protein is required to stimulate the transcriptional activity of the protein. Human HMG-1 and HMG-2 both contain two DNA-binding domains, termed HMG boxes. HMG proteins bind single-stranded DNA but induce conformational changes in double-stranded DNA alone.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.