| Cat.No.: | EAb-2845 |
| Product Name: | KMT2D/MLL2 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect KMT2D/MLL2 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human KMT2D/ MLL2 aa 4363-4491. |
| Immunogen Sequence: | AQLADTLFSKGLGPWDPPDNLAETQKPEQSSLVPGHLDQVNGQVVPEASQ LSIKQEPREEPCALGAQSVKREANGEPIGAPGTSNHLLLAGPRSEAGHLL LQKLLRAKNVQLSTGRGSEGLRAEINGHI |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS |
| Applications: | IHC-P, ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | O14686 |
| Alternative Name: | AAD10 antibody/ALL1 related gene antibody/ALL1-related protein antibody |
| Scientific Background: | Histone methyltransferase. Methylates 'Lys-4' of histone H3 (H3K4me). H3K4me represents a specific tag for epigenetic transcriptional activation. Plays a central role in beta-globin locus transcription regulation by being recruited by NFE2. Acts as a coactivator for estrogen receptor by being recruited by ESR1, thereby activating transcription. Plays an important role in controlling bulk H3K4me during oocyte growth and preimplantation development. Required during the transcriptionally active period of oocyte growth for the establishment and/or maintenance of bulk H3K4 trimethylation (H3K4me3), global transcriptional silencing that preceeds resumption of meiosis, oocyte survival and normal zygotic genome activation. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0170 | MI-3 | Inquiry |
| BSM-0187 | OICR-9429 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0172 | Human KMT2C / MLL3 peptide | Inquiry |
| ◆ Cell Lines | ||
| CL-0216 | Human KMT2A Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Research Kits | ||
| EKIT-0285 | MLL1 Complex Chemiluminescent Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| MLH1 | MLL | mll1 | MLL2 |
| MLL3 | MLL4 | MLL5 | MLLT1 More > |
| MLLT3 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools