USP35 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2837
Product Name:  USP35 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect USP35
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human USP35 aa 602-680.
Immunogen Sequence:  PPERCRRRRLGSVMRPTEDITARELPPPTSAQGPGRVGPRRQRKHCITED TPPTSLYIEGLDSKEAGGQSSQEERIERE
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  ICC/IF, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9P2H5
Alternative Name:  Deubiquitinating enzyme 35 antibody/Gm1088 antibody/Gm493 antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.