PARP3/IRT1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2801
Product Name:  PARP3/IRT1 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect PARP3/IRT1
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human PARP3/IRT1 aa 11-56.
Immunogen Sequence:  TEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSS
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.3; 0.05% Sodium azide, 99% PBS
Applications:  WB
Species Reactivity:  Mouse, Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9Y6F1
Alternative Name:  ADP ribosyltransferase (NAD+; poly (ADP ribose) antibody/ADP ribosyltransferase diphtheria toxin like 3 antibody/ADPRT-3 antibody
Scientific Background:  Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. May link the DNA damage surveillance network to the mitotic fidelity checkpoint. Negatively influences the G1/S cell cycle progression without interfering with centrosome duplication. Binds DNA. May be involved in the regulation of PRC2 and PRC3 complex-dependent gene silencing.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.