| Cat.No.: | EAb-2801 |
| Product Name: | PARP3/IRT1 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect PARP3/IRT1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide within Human PARP3/IRT1 aa 11-56. |
| Immunogen Sequence: | TEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.3; 0.05% Sodium azide, 99% PBS |
| Applications: | WB |
| Species Reactivity: | Mouse, Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9Y6F1 |
| Alternative Name: | ADP ribosyltransferase (NAD+; poly (ADP ribose) antibody/ADP ribosyltransferase diphtheria toxin like 3 antibody/ADPRT-3 antibody |
| Scientific Background: | Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks. May link the DNA damage surveillance network to the mitotic fidelity checkpoint. Negatively influences the G1/S cell cycle progression without interfering with centrosome duplication. Binds DNA. May be involved in the regulation of PRC2 and PRC3 complex-dependent gene silencing. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0059 | PARP Monoclonal Antibody | Inquiry |
| EAb-0061 | PARP Polyclonal Antibody | Inquiry |
| EAb-0062 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0063 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0064 | Paf1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| IRF-2 | IRF-3 | IRF-4 | IRF-5 |
| IRT1 | PABPC1L2A | PABPC5 | PABPN1 |
| PAD | PAD1 | PAD2 | PAD3 |
| PAD4 | PADI1 | PADI2 | PADI3 |
| PADI4 | PADI6 | PAF1 | PAN2 More > |
| PAPD1 | PAPD4 | PAPD5 | PAPD7 |
| PAPOLA | PAPOLB | PARD6A | PARG |
| PARK2 | PARK7 | PARP | PARP1 |
| PARP10 | PARP11 | PARP12 | PARP14 |
| PARP15 | PARP16 | PARP2 | PARP3 |
| PARP4 | PARP6 | PARP7 | PARP8 |
| PARP9 | PAX5 | PAX6 | PAX7 |
| PAX9 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools