PRMT3 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2796
Product Overview:  Rabbit polyclonal to detect PRMT3
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 of Human PRMT3
Immunogen Sequence:  MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPC
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, Tris citrate/phosphate
Applications:  WB, IP
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  NP_005779.1
Alternative Name:  2010005E20Rik antibody/2410018A17Rik antibody/AL033309 antibody
Scientific Background:  Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.