| Cat.No.: | EAb-2793 |
| Product Name: | SIRT5 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect SIRT5 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant full length protein corresponding to Human SIRT5 aa 1-310. |
| Immunogen Sequence: | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKA KHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWE FYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAG TKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIP VEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGT SSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA LACHENETVS |
| Host: | Rabbit |
| Isotype: | IgG |
| Appearance: | Liquid |
| Formulation: | 100% PBS |
| Applications: | WB |
| Species Reactivity: | Mouse, Rat, Cow, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9NXA8 |
| Alternative Name: | NAD dependent deacetylase sirtuin 5 antibody/NAD dependent lysine demalonylase and desuccinylase sirtuin 5 mitochondrial antibody/NAD dependent protein deacylase sirtuin 5 mitochondrial antibody |
| Scientific Background: | NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins (PubMed:21908771, PubMed:22076378, PubMed:24703693). Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting (PubMed:22076378, PubMed:24703693). Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species (PubMed:24140062). Modulates ketogenesis through the desuccinylation and activation of HMGCS2 (By similarity). Has weak NAD-dependent protein deacetylase activity; however this activity may not be physiologically relevant in vivo. Can deacetylate cytochrome c (CYCS) and a number of other proteins in vitro such as UOX. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools