KDM6A/UTX Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2787
Product Name:  KDM6A/UTX Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect KDM6A/UTX
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide corresponding to Human KDM6A/ UTX aa 1352-1401 (C terminal).
Immunogen Sequence:  KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 2% Sucrose, PBS
Applications:  WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O15550
Alternative Name:  bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX) antibody/bA386N14.2 antibody/bA386N14.2 ubiquitously transcribed X chromosome tetratricopeptide repeat protein UTX antibody
Scientific Background:  Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.