| Cat.No.: | EAb-2787 |
| Product Overview: | Rabbit polyclonal to detect KDM6A/UTX |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide corresponding to Human KDM6A/ UTX aa 1352-1401 (C terminal). |
| Immunogen Sequence: | KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 2% Sucrose, PBS |
| Applications: | WB |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | O15550 |
| Alternative Name: | bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX) antibody/bA386N14.2 antibody/bA386N14.2 ubiquitously transcribed X chromosome tetratricopeptide repeat protein UTX antibody |
| Scientific Background: | Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitent with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
| CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
| CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A More > |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | UTF1 | UTX |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools