JHDM1D Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2785
Product Name:  JHDM1D Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect JHDM1D
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human JHDM1D aa 411-501.
Immunogen Sequence:  LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVR PGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.02% Sodium azide, 40% Glycerol, PBS
Applications:  ICC/IF, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q6ZMT4
Alternative Name:  JHDM1D antibody/jmjc containing protein antibody/JmjC domain-containing histone demethylation protein 1D antibody
Scientific Background:  Histone demethylase required for brain development. Specifically demethylates dimethylated 'Lys-9' and 'Lys-27' (H3K9me2 and H3K27me2, respectively) of histone H3 and monomethylated histone H4 'Lys-20' residue (H4K20Me1), thereby playing a central role in histone code. Specifically binds trimethylated 'Lys-4' of histone H3 (H3K4me3), affecting histone demethylase specificity: in presence of H3K4me3, it has no demethylase activity toward H3K9me2, while it has high activity toward H3K27me2. Demethylates H3K9me2 in absence of H3K4me3. Has activity toward H4K20Me1 only when nucleosome is used as a substrate and when not histone octamer is used as substrate.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.