Cat.No.: | EAb-2775 |
Product Name: | KAT8/MYST1/MOF Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect KAT8/MYST1/MOF |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment corresponding to Human KAT8/ MYST1/ MOF aa 1-168. |
Immunogen Sequence: | MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE PEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRL DEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEIN HVQKTYAEMDPTTAALEK |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Protein G purified |
Appearance: | Liquid |
Formulation: | pH: 7.4; 0.03% Proclin, 50% Glycerol, PBS |
Applications: | WB |
Species Reactivity: | Mouse, Rat, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Q9H7Z6 |
Alternative Name: | Histone acetyltransferase KAT8 antibody/Histone acetyltransferase MYST1 antibody/hMOF antibody |
Scientific Background: | Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
◆ Extracts & Lysates | ||
EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools