| Cat.No.: | EAb-2775 |
| Product Overview: | Rabbit polyclonal to detect KAT8/MYST1/MOF |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human KAT8/ MYST1/ MOF aa 1-168. |
| Immunogen Sequence: | MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE PEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRL DEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEIN HVQKTYAEMDPTTAALEK |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein G purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.4; 0.03% Proclin, 50% Glycerol, PBS |
| Applications: | WB |
| Species Reactivity: | Mouse, Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9H7Z6 |
| Alternative Name: | Histone acetyltransferase KAT8 antibody/Histone acetyltransferase MYST1 antibody/hMOF antibody |
| Scientific Background: | Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0073 | Anacardic Acid | Inquiry |
| ◆ Antibodies | ||
| EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
| CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| Kaiso | KANSL2 | KAP1 | KAT13A |
| KAT13D | KAT2A | KAT2B | KAT4 |
| KAT5 | KAT6A | KAT6B | KAT7 |
| KAT8 | KAT9 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.