SIRT6 Monoclonal Antibody (OTI1G3)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2773
Product Name:  SIRT6 Monoclonal Antibody (OTI1G3)
Product Overview:  Mouse monoclonal (OTI1G3) to detect SIRT6
Antibody Type:  Monoclonal
Clone Designation:  OTI1G3
Immunogen:  Recombinant fragment corresponding to Human SIRT6 aa 88-352. Produced in E.coli
Immunogen Sequence:  SARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMF VEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILD WEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLV IVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALP PLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPT SPAPHRPPKRVKAKA
Host:  Mouse
Isotype:  IgG1
Purification:  Affinity purified
Appearance:  Liquid
Formulation:  pH: 7.30; 0.02% Sodium azide, PBS, 50% Glycerol, 1% BSA
Applications:  WB, ICC/IF
Recommended Dilutions/Conditions:  Western Blot 1:500-2000; Immunocytochemistry/Immunofluorescence 1:100
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Dog, Human, African green monkey
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q8N6T7; NP_057623
Alternative Name:  2810449N18Rik antibody/AI043036 antibody/Mono ADP ribosyltransferase sirtuin 6 antibody
Scientific Background:  NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Acts as a corepressor of the transcription factor HIF1A to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Regulates the production of TNF protein. Has a role in the regulation of life span (By similarity). Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.