PRDM5 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2757
Product Overview:  Rabbit polyclonal to detect PRDM5
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human PRDM5 aa 258-328.
Immunogen Sequence:  GDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKCSSA SSLQEHRKIHEIFDCQECMKK
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  IHC-P, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NQX1
Alternative Name:  BCS2 antibody/PFM 2 antibody/PFM2 antibody
Scientific Background:  Sequence-specific DNA-binding transcription factor. Represses transcription at least in part by recruitment of the histone methyltransferase EHMT2/G9A and histone deacetylases such as HDAC1. Regulates hematopoiesis-associated protein-coding and microRNA (miRNA) genes.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.