TRIM13 Polyclonal Antibody (N-terminal)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2735
Product Name:  TRIM13 Polyclonal Antibody (N-terminal)
Product Overview:  Mouse polyclonal to detect TRIM13 - N-terminal
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment (GST-tag) corresponding to Human TRIM13 aa 1-100 (N terminal).
Immunogen Sequence:  MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPA PFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Host:  Mouse
Isotype:  IgG
Purification:  Whole antiserum
Appearance:  Liquid
Formulation:  50% Glycerol
Applications:  WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O60858; NP_005789.2
Alternative Name:  B cell chronic lymphocytic leukemia tumor suppressor Leu5 antibody/B-cell chronic lymphocytic leukemia tumor suppressor Leu5 antibody/CAR antibody
Scientific Background:  E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.