KDM4B/JMJD2B Monoclonal Antibody (3A6H6)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2724
Product Name:  KDM4B/JMJD2B Monoclonal Antibody (3A6H6)
Product Overview:  Mouse monoclonal (3A6H6) to detect KDM4B/JMJD2B
Antibody Type:  Monoclonal
Clone Designation:  3A6H6
Immunogen:  Recombinant fragment corresponding to Human KDM4B/ JMJD2B aa 960-1096 (C terminal). Expressed in E. coli.
Immunogen Sequence:  NLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVE FEDGSQLTVKRGDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAK RPRVGTPLATEDSGRSQDYVAFVESLLQVQGRPGAPF
Host:  Mouse
Isotype:  IgG1
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  0.05% Sodium azide, PBS
Applications:  WB, Flow Cyt
Species Reactivity:  Mouse, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O94953
Alternative Name:  JHDM3B antibody/JmjC domain-containing histone demethylation protein 3B antibody/JMJD2B antibody
Scientific Background:  Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27', H3 'Lys-36' nor H4 'Lys-20'. Only able to demethylate trimethylated H3 'Lys-9', with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.