PRMT2/HMT1 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2722
Product Overview:  Rabbit polyclonal to detect PRMT2/HMT1
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide corresponding to Human PRMT2/HMT1 aa 38-87 (N terminal).
Immunogen Sequence:  AADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGK
Host:  Rabbit
Isotype:  IgG
Purification:  Protein A purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 2% Sucrose, PBS
Applications:  ICC/IF, WB, IHC-P
Species Reactivity:  Mouse, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Alternative Name:  ANM2_HUMAN antibody/EC 2.1.1. antibody/histone arginine N methyltransferase PRMT2 antibody
Scientific Background:  Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.