| Cat.No.: | EAb-2722 |
| Product Overview: | Rabbit polyclonal to detect PRMT2/HMT1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Synthetic peptide corresponding to Human PRMT2/HMT1 aa 38-87 (N terminal). |
| Immunogen Sequence: | AADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGK |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein A purified |
| Appearance: | Liquid |
| Formulation: | 0.09% Sodium azide, 2% Sucrose, PBS |
| Applications: | ICC/IF, WB, IHC-P |
| Species Reactivity: | Mouse, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Alternative Name: | ANM2_HUMAN antibody/EC 2.1.1. antibody/histone arginine N methyltransferase PRMT2 antibody |
| Scientific Background: | Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| BSM-0047 | SGC707 | Inquiry |
| ◆ Antibodies | ||
| EAb-0048 | PRMT6 Polyclonal Antibody | Inquiry |
| EAb-0049 | PRMT7 Polyclonal Antibody | Inquiry |
| EAb-0050 | PRMT1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | Pr-SET7 | PRC1 |
| PRC2 | PRDM1 | PRDM10 | PRDM11 More > |
| PRDM12 | PRDM13 | PRDM14 | PRDM15 |
| PRDM16 | PRDM17 | PRDM2 | PRDM3 |
| PRDM4 | PRDM5 | PRDM6 | PRDM7 |
| PRDM8 | PRDM9 | PREP1 | PRIM2 |
| PRKAA2 | PRKCA | PRKCB | PRKCE |
| PRKDC | PRKRIP1 | PRMT | prmt1 |
| PRMT2 | PRMT3 | PRMT5 | prmt6 |
| PRMT7 | PRMT8 | PRMT9 | Progerin |
| Protamine 2 | Prox1 | PRPF31 | PRPF40A |
| PRSS12 | PRSS55 | PRTFDC1 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.