| Cat.No.: | EAb-2715 |
| Product Overview: | Rabbit polyclonal to detect SUZ12 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human SUZ12 aa 131-305. |
| Immunogen Sequence: | TFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSL AVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEEL PARRKRNREDGEKTFVAQMTVFDKN |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein G purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS |
| Applications: | IHC-P, WB, ICC/IF |
| Species Reactivity: | Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q15022 |
| Alternative Name: | ChET 9 protein antibody/CHET9 antibody/Chromatin precipitated E2F target 9 protein antibody |
| Scientific Background: | Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0100 | Chaetocin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
| EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
| EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| SUDS3 | SUMO | SUMO1 | SUMO2 |
| SUMO3 | SUN1 | Surf6 | suv39h1 |
| SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
| SUZ12 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools