KMT3C/SMYD2 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2703
Product Overview:  Rabbit polyclonal to detect KMT3C/SMYD2
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human KMT3C/ SMYD2 aa 115-272.
Immunogen Sequence:  KQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHL GFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVI VTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCEC QECTTKDK
Host:  Rabbit
Isotype:  IgG
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS
Applications:  IHC-P, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NRG4
Alternative Name:  Histone methyltransferase SMYD2 antibody/HSKM B antibody/HSKM-B antibody
Scientific Background:  Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.