SIRT3 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2697
Product Name:  SIRT3 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect SIRT3
Antibody Type:  Polyclonal
Immunogen:  Recombinant full length protein corresponding to Human SIRT3 aa 1-339.
Immunogen Sequence:  MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGL RGSHGARGEPLDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRR SISFSVGASSVVGSGGSSDK
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.3; 0.02% Sodium azide, 49% PBS, 50% Glycerol
Applications:  WB, IHC-P
Species Reactivity:  Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Alternative Name:  hSIRT 3 antibody/hSIRT3 antibody/Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase antibody
Scientific Background:  NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.