Cat.No.: | EAb-2697 |
Product Name: | SIRT3 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect SIRT3 |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant full length protein corresponding to Human SIRT3 aa 1-339. |
Immunogen Sequence: | MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGL RGSHGARGEPLDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRR SISFSVGASSVVGSGGSSDK |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | pH: 7.3; 0.02% Sodium azide, 49% PBS, 50% Glycerol |
Applications: | WB, IHC-P |
Species Reactivity: | Rat, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Alternative Name: | hSIRT 3 antibody/hSIRT3 antibody/Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase antibody |
Scientific Background: | NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5O. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
Related Gene / Proteins | |||
Siah2 | SIK1 | SIMC1 | SIN3A |
SIN3B | SIP1 | Sir2p | SIRT |
SIRT1 | SIRT2 | SIRT3 | SIRT4 |
SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools