| Cat.No.: | EAb-2695 |
| Product Name: | EZH1 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect EZH1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human EZH1 aa 160-280. |
| Immunogen Sequence: | GEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDL PVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRE LTEMSDPNALPPQCTPNIDGP |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.3; 0.02% Sodium azide, 49% PBS, 50% Glycerol |
| Applications: | ICC/IF, WB, IHC-P |
| Species Reactivity: | Mouse, Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q92800 |
| Alternative Name: | Enhancer of zeste homolog 1 (Drosophila) antibody/Enhancer of zeste homolog 1 antibody/ENX-2 antibody |
| Scientific Background: | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH1-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0006 | GSK343 | Inquiry |
| BSM-0059 | 3-Deazaneplanocin A | Inquiry |
| BSM-0060 | 3-Deazaneplanocin A hydrochloride | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0024 | Recombinant Human EZH1 293 Cell Lysate | Inquiry |
| EL-0025 | Recombinant Human EZH2 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| ezh1 | EZH2 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools