EZH1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2695
Product Name:  EZH1 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect EZH1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human EZH1 aa 160-280.
Immunogen Sequence:  GEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDL PVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRE LTEMSDPNALPPQCTPNIDGP
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.3; 0.02% Sodium azide, 49% PBS, 50% Glycerol
Applications:  ICC/IF, WB, IHC-P
Species Reactivity:  Mouse, Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q92800
Alternative Name:  Enhancer of zeste homolog 1 (Drosophila) antibody/Enhancer of zeste homolog 1 antibody/ENX-2 antibody
Scientific Background:  Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH1 complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Required for embryonic stem cell derivation and self-renewal, suggesting that it is involved in safeguarding embryonic stem cell identity. Compared to EZH1-containing complexes, it is less abundant in embryonic stem cells, has weak methyltransferase activity and plays a less critical role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation.
Product Types
◆ Bioactive Small Molecules
BSM-0006 GSK343 Inquiry
BSM-0059 3-Deazaneplanocin A Inquiry
BSM-0060 3-Deazaneplanocin A hydrochloride Inquiry
◆ Extracts & Lysates
EL-0024 Recombinant Human EZH1 293 Cell Lysate Inquiry
EL-0025 Recombinant Human EZH2 293 Cell Lysate Inquiry
Related Gene / Proteins
ezh1 EZH2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.