SIRT4 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2691
Product Name:  SIRT4 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect SIRT4
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment (His-tag) corresponding to Rat SIRT4 aa 60-255. (Expressed in E.coli).
Immunogen Sequence:  AGISTESGIPDYRSEKVGLYARTDRRPIQHIDFIRSAPVRQRYWARNFVG WPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAGNQRLTELHG CMHRVLCLSCGEQTARRVLQDRFQALNPSWSAEAQGVAPDGDVFLTEEQV RSFRVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHQRVKEADSLLV
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.40; 0.02% Sodium azide, PBS, 50% Glycerol
Applications:  WB, IHC-P
Species Reactivity:  Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  G3V641
Alternative Name:  MGC130046 antibody/MGC130047 antibody/MGC57437 antibody
Scientific Background:  Silent information regulator (Sir2)-like family deacetylases (also known as sirtuins) are highly conserved proteins and have important roles in the regulation of metabolism, inflammation, cellular survival growth and differentiation. Sirtuins, including SIRT1-7, are human homologs of yeast Sir2p. Sirtuins are NAD-dependent protein ADP-ribosyl transferase which catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1. SIRT4 localizes to mitochondria, inhibits glutamate dehydrogenase (GLUD1), and may involve in the regulation of insulin secretion.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.