Cat.No.: | EAb-2691 |
Product Name: | SIRT4 Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect SIRT4 |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fragment (His-tag) corresponding to Rat SIRT4 aa 60-255. (Expressed in E.coli). |
Immunogen Sequence: | AGISTESGIPDYRSEKVGLYARTDRRPIQHIDFIRSAPVRQRYWARNFVG WPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAGNQRLTELHG CMHRVLCLSCGEQTARRVLQDRFQALNPSWSAEAQGVAPDGDVFLTEEQV RSFRVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHQRVKEADSLLV |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | pH: 7.40; 0.02% Sodium azide, PBS, 50% Glycerol |
Applications: | WB, IHC-P |
Species Reactivity: | Rat, Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | G3V641 |
Alternative Name: | MGC130046 antibody/MGC130047 antibody/MGC57437 antibody |
Scientific Background: | Silent information regulator (Sir2)-like family deacetylases (also known as sirtuins) are highly conserved proteins and have important roles in the regulation of metabolism, inflammation, cellular survival growth and differentiation. Sirtuins, including SIRT1-7, are human homologs of yeast Sir2p. Sirtuins are NAD-dependent protein ADP-ribosyl transferase which catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1. SIRT4 localizes to mitochondria, inhibits glutamate dehydrogenase (GLUD1), and may involve in the regulation of insulin secretion. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
Related Gene / Proteins | |||
Siah2 | SIK1 | SIMC1 | SIN3A |
SIN3B | SIP1 | Sir2p | SIRT |
SIRT1 | SIRT2 | SIRT3 | SIRT4 |
SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools