| Cat.No.: | EAb-2691 |
| Product Name: | SIRT4 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect SIRT4 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment (His-tag) corresponding to Rat SIRT4 aa 60-255. (Expressed in E.coli). |
| Immunogen Sequence: | AGISTESGIPDYRSEKVGLYARTDRRPIQHIDFIRSAPVRQRYWARNFVG WPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAGNQRLTELHG CMHRVLCLSCGEQTARRVLQDRFQALNPSWSAEAQGVAPDGDVFLTEEQV RSFRVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHQRVKEADSLLV |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.40; 0.02% Sodium azide, PBS, 50% Glycerol |
| Applications: | WB, IHC-P |
| Species Reactivity: | Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | G3V641 |
| Alternative Name: | MGC130046 antibody/MGC130047 antibody/MGC57437 antibody |
| Scientific Background: | Silent information regulator (Sir2)-like family deacetylases (also known as sirtuins) are highly conserved proteins and have important roles in the regulation of metabolism, inflammation, cellular survival growth and differentiation. Sirtuins, including SIRT1-7, are human homologs of yeast Sir2p. Sirtuins are NAD-dependent protein ADP-ribosyl transferase which catalyzes the transfer of ADP-ribosyl groups onto target proteins, including mitochondrial GLUD1. SIRT4 localizes to mitochondria, inhibits glutamate dehydrogenase (GLUD1), and may involve in the regulation of insulin secretion. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools