ING3 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2685
Product Overview:  Rabbit polyclonal to detect ING3
Antibody Type:  Polyclonal
Immunogen:  Recombinant full length protein corresponding to Human ING3 aa 1-92. Isoform 2
Immunogen Sequence:  MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.3; 0.02% Sodium azide, 49% PBS, 50% Glycerol
Applications:  IHC-P, WB, ICC/IF
Species Reactivity:  Mouse, Rat, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NXR8-2
Alternative Name:  1300013A07Rik antibody/Eaf 4 antibody/Eaf4 antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.