| Cat.No.: | EAb-2685 |
| Product Overview: | Rabbit polyclonal to detect ING3 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant full length protein corresponding to Human ING3 aa 1-92. Isoform 2 |
| Immunogen Sequence: | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.3; 0.02% Sodium azide, 49% PBS, 50% Glycerol |
| Applications: | IHC-P, WB, ICC/IF |
| Species Reactivity: | Mouse, Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9NXR8-2 |
| Alternative Name: | 1300013A07Rik antibody/Eaf 4 antibody/Eaf4 antibody |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
| EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
| EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| ING1 | ING2 | ING3 | ING4 |
| ING5 | INHAT-1 | INHAT-2 | Ini1 |
| INSL6 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
