| Cat.No.: | EAb-2674 |
| Product Overview: | Rabbit polyclonal to detect Ube4a |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human Ube4a aa 797-1066. |
| Immunogen Sequence: | FLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFGQLARFH NIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGAL KVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQ TVRVLKKINKPGNMIMAFSNLAERIKSLADLQQQEEETYADACDEFLDPI MSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTE LKEKIQRWLAERKQQKEQLE |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.30; 0.02% Sodium azide, PBS, 50% Glycerol |
| Applications: | IHC-P, WB |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q14139 |
| Alternative Name: | E4 antibody/KIAA0126 antibody/MGC133315 antibody |
| Scientific Background: | Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0026 | Human UBAP1 Knockout Cell Line | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0162 | Synthetic Human Ubiquitin protein (Biotin) | Inquiry |
| SP-0163 | Human Ubiquitin peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0174 | UBE2G1 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0315 | NSC 697923 | Inquiry |
| Related Gene / Proteins | |||
| UB2D1 | UB2D2 | UB2D3 | UB2R1 |
| UBA1 | UBA5 | UBA7 | UBAP1 |
| UBB | UBC | UBC12 | Ubc13 |
| Ubc3B | UbcH1 | UbcH2 | UbcH3 |
| UbcH5a | UbcH5b | UbcH5c | UbcH8 More > |
| UBD | UBE1L | UBE2B | UBE2C |
| UBE2D1 | UBE2D3 | UBE2DNL | UBE2E1 |
| UBE2E2 | UBE2E3 | UBE2G1 | UBE2G2 |
| UBE2H | UBE2I | UBE2K | UBE2L3 |
| UBE2L6 | UBE2M | UBE2N | UBE2O |
| UBE2Q2 | UBE2R1 | UBE2R2 | UBE2T |
| UBE2V1 | UBE2V2 | UBE2W | UBE3A |
| Ube4a | Ubiquitin | UBL7 | Ubn1 |
| UBP5 | UBR2 | UBTD1 | UBTD2 |
| UBXN10 | UBXN2B | UBXN6 | UBXN8 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.