| Cat.No.: | EAb-2661 |
| Product Overview: | Rabbit polyclonal to detect KAT3B/p300 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment (GST-tag) corresponding to Rat KAT3B/ p300 aa 1-158. (Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli). |
| Immunogen Sequence: | MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINS TELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGP GQVMASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGMGSSGPNQGPTQS TAGMMNSP |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.4; 0.02% Sodium azide, PBS, 50% Glycerol |
| Applications: | IHC-P, WB |
| Species Reactivity: | Rat |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q91XT0 |
| Alternative Name: | E1A associated protein p300 antibody/E1A binding protein p300 antibody/E1A-associated protein p300 antibody |
| Scientific Background: | Functions as histone acetyltransferase and regulates transcription via chromatin remodeling. Acetylates all four core histones in nucleosomes. Histone acetylation gives an epigenetic tag for transcriptional activation. Mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. Mediates acetylation of histone H3 at 'Lys-122' (H3K122ac), a modification that localizes at the surface of the histone octamer and stimulates transcription, possibly by promoting nucleosome instability. Mediates acetylation of histone H3 at 'Lys-27' (H3K27ac). Also functions as acetyltransferase for nonhistone targets. Acetylates 'Lys-131' of ALX1 and acts as its coactivator. Acetylates SIRT2 and is proposed to indirectly increase the transcriptional activity of TP53 through acetylation and subsequent attenuation of SIRT2 deacetylase function. Acetylates HDAC1 leading to its inactivation and modulation of transcription. Acts as a TFAP2A-mediated transcriptional coactivator in presence of CITED2. Plays a role as a coactivator of NEUROD1-dependent transcription of the secretin and p21 genes and controls terminal differentiation of cells in the intestinal epithelium. Promotes cardiac myocyte enlargement. Can also mediate transcriptional repression. Binds to and may be involved in the transforming capacity of the adenovirus E1A protein. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Acetylates FOXO1 and enhances its transcriptional activity. Acetylates BCL6 wich disrupts its ability to recruit histone deacetylases and hinders its transcriptional repressor activity. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0038 | CTPB | Inquiry |
| BSM-0073 | Anacardic Acid | Inquiry |
| BSM-0094 | C646 | Inquiry |
| BSM-0108 | Curcumin, Curcuma longa (High Purity) | Inquiry |
| ◆ Cell Lines | ||
| CL-0061 | Human EP300 Knockout Cell Line 13bp deletion | Inquiry |
| Related Gene / Proteins | |||
| EP300 | EPC1 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools