Ube4a Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2655
Product Name:  Ube4a Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect Ube4a
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human Ube4a aa 653-742.
Immunogen Sequence:  SLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPNPLVSSV FHRKRVFCNFQYAPQLAEALIKVFVDIEFTGDPHQFEQKF
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.2; 0.02% Sodium azide, 40% Glycerol, 59% PBS
Applications:  ICC/IF, WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q14139
Alternative Name:  E4 antibody/KIAA0126 antibody/MGC133315 antibody
Scientific Background:  Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.