| Cat.No.: | EAb-2653 |
| Product Overview: | Rabbit polyclonal to detect KMT1B/SUV39H2 - C-terminal |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human KMT1B/ SUV39H2 aa 201-410 (C terminal). |
| Immunogen Sequence: | CCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQY SLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTR LPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKC GAVTCRGYLN |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.3; 0.02% Sodium azide, 50% Glycerol, 49% PBS |
| Applications: | IHC-P, WB |
| Species Reactivity: | Mouse, Rat, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9H5I1 |
| Alternative Name: | FLJ23414 antibody/H3 K9 HMTase 2 antibody/H3-K9-HMTase 2 antibody |
| Scientific Background: | Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher order chromatin organization during spermatogenesis. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0100 | Chaetocin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
| EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
| EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| SUDS3 | SUMO | SUMO1 | SUMO2 |
| SUMO3 | SUN1 | Surf6 | suv39h1 More > |
| SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
| SUZ12 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.