HDAC6 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2639
Product Name:  HDAC6 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect HDAC6
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment (His-tag) corresponding to Human HDAC6 aa 166-348. N-terminal tag. (Expressed in E.coli).
Immunogen Sequence:  VLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGH HAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFD QDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMR DADYIAAFLHVLLPVALEFQPQLVLVAAGFDAL
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.4; 0.02% Sodium azide, PBS, 50% Glycerol
Applications:  WB, IHC-P
Species Reactivity:  Human, Pig
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9UBN7-1
Alternative Name:  CPBHM antibody/FLJ16239 antibody/HD 6 antibody
Scientific Background:  Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.