KAT4/TBP Associated Factor 1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2567
Product Name:  KAT4/TBP Associated Factor 1 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect KAT4/TBP Associated Factor 1
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human KAT4/ TBP Associated Factor 1 aa 1823-1872 (C terminal).
Immunogen Sequence:  YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 2% Sucrose, PBS
Applications:  IHC-P, ELISA, WB, ChIP
Species Reactivity:  Mouse, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P21675
Alternative Name:  BA2R antibody/CCG1 antibody/CCGS antibody
Scientific Background:  Largest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.