| Cat.No.: | EAb-2557 |
| Product Name: | KDM5C/Jarid1C/SMCX Polyclonal Antibody (N-terminal) |
| Product Overview: | Rabbit polyclonal to detect KDM5C/Jarid1C/SMCX - N-terminal |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human KDM5C/ Jarid1C/ SMCX aa 1-250. Isoform 4. |
| Immunogen Sequence: | MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPA IVVEEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMY QSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQ PDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGLMAKDKTLRKKDKEGPEC PPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Whole antiserum |
| Appearance: | Liquid |
| Applications: | IP, ICC/IF, WB |
| Species Reactivity: | Mouse, Rat, Chicken, Human, Xenopus laevis |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P41229-4 |
| Alternative Name: | DXS1272E antibody/Histone demethylase JARID1C antibody/JARID1C antibody |
| Scientific Background: | Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. Participates in transcriptional repression of neuronal genes by recruiting histone deacetylases and REST at neuron-restrictive silencer elements. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0002 | AT9283 | Inquiry |
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0019 | SMARCA4 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0063 | Recombinant Human SMARCC2 293 Cell Lysate | Inquiry |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
