| Cat.No.: | EAb-2472 |
| Product Name: | LARP1 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect LARP1 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human LARP1 aa 125-216. |
| Immunogen Sequence: | NPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAI NWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSD |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol |
| Applications: | IHC-P |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q6PKG0 |
| Alternative Name: | 1810024J12Rik antibody/3110040D16Rik antibody/KIAA0731 antibody |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0180 | Human LASP1 Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-1284 | LAS1L Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-1286 | LAS1L Polyclonal Antibody, FITC Conjugated | Inquiry |
| EAb-1288 | LAS1L Polyclonal Antibody, Biotin Conjugated | Inquiry |
| EAb-1295 | LAS1L Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| Lamin A | Lamin B1 | LARP1 | LARP7 |
| LAS1L | LASP1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools