LARP1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2472
Product Name:  LARP1 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect LARP1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human LARP1 aa 125-216.
Immunogen Sequence:  NPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAI NWPTPGEIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSD
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q6PKG0
Alternative Name:  1810024J12Rik antibody/3110040D16Rik antibody/KIAA0731 antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.