HMGB4 Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2468
Product Overview:  Rabbit polyclonal to detect HMGB4
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human HMGB4 aa 96-173.
Immunogen Sequence:  PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQR VALLRAKYFEELELYRKQCNARKKYRMS
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, 40% Glycerol, PBS
Applications:  IHC-P, WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q8WW32
Alternative Name:  High mobility group box 4 antibody/High mobility group protein B4 antibody/HMG2 like antibody

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.