| Cat.No.: | EAb-2463 |
| Product Overview: | Rabbit polyclonal to detect HP1 alpha |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant full length protein (GST-tag) corresponding to Human HP1 alpha aa 1-191. |
| Immunogen Sequence: | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein G purified |
| Appearance: | Liquid |
| Formulation: | 0.05% Sodium azide, 0.05% Proclin, PBS |
| Applications: | WB, ICC/IF |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | P45973 |
| Alternative Name: | Antigen p25 antibody/CBX5 antibody/CBX5_HUMAN antibody |
| Scientific Background: | Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0051 | Human CBX1 Knockout Cell Line 32bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0082 | HP1α, β and γ Polyclonal Antibody | Inquiry |
| EAb-0083 | HP1α Polyclonal Antibody | Inquiry |
| EAb-0149 | CBX1 Polyclonal Antibody | Inquiry |
| EAb-0677 | CBX1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HP1 | HP1BP3 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.