Cat.No.: | EAb-2463 |
Product Name: | HP1-alpha Polyclonal Antibody |
Product Overview: | Rabbit polyclonal to detect HP1 alpha |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant full length protein (GST-tag) corresponding to Human HP1 alpha aa 1-191. |
Immunogen Sequence: | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
Host: | Rabbit |
Isotype: | IgG |
Purification: | Protein G purified |
Appearance: | Liquid |
Formulation: | 0.05% Sodium azide, 0.05% Proclin, PBS |
Applications: | WB, ICC/IF |
Species Reactivity: | Human |
Storage: | -20°C. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | P45973 |
Alternative Name: | Antigen p25 antibody/CBX5 antibody/CBX5_HUMAN antibody |
Scientific Background: | Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. |
Product Types | ||
◆ Cell Lines | ||
CL-0051 | Human CBX1 Knockout Cell Line 32bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0082 | HP1α, β and γ Polyclonal Antibody | Inquiry |
EAb-0083 | HP1α Polyclonal Antibody | Inquiry |
EAb-0149 | CBX1 Polyclonal Antibody | Inquiry |
EAb-0677 | CBX1 Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
HP1 | HP1BP3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools