HP1-alpha Polyclonal Antibody

Inquiry

  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2463
Product Overview:  Rabbit polyclonal to detect HP1 alpha
Antibody Type:  Polyclonal
Immunogen:  Recombinant full length protein (GST-tag) corresponding to Human HP1 alpha aa 1-191.
Immunogen Sequence:  MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Host:  Rabbit
Isotype:  IgG
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  0.05% Sodium azide, 0.05% Proclin, PBS
Applications:  WB, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  P45973
Alternative Name:  Antigen p25 antibody/CBX5 antibody/CBX5_HUMAN antibody
Scientific Background:  Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.