Brd4 Monoclonal Antibody (CL1115)


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2444
Product Overview:  Mouse monoclonal (CL1115) to detect Brd4
Antibody Type:  Monoclonal
Clone Designation:  CL1115
Immunogen:  Recombinant fragment corresponding to Human Brd4 aa 1031-1172.
Immunogen Sequence:  PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLR PEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Host:  Mouse
Isotype:  IgG1
Purification:  Protein A purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  IHC-P, WB
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O60885
Alternative Name:  Brd4 antibody/BRD4-NUT FUSION antibody/BRD4-NUT fusion oncoprotein antibody
Scientific Background:  Plays a role in a process governing chromosomal dynamics during mitosis.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart