| Cat.No.: | EAb-2444 |
| Product Overview: | Mouse monoclonal (CL1115) to detect Brd4 |
| Antibody Type: | Monoclonal |
| Clone Designation: | CL1115 |
| Immunogen: | Recombinant fragment corresponding to Human Brd4 aa 1031-1172. |
| Immunogen Sequence: | PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLR PEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
| Host: | Mouse |
| Isotype: | IgG1 |
| Purification: | Protein A purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol |
| Applications: | IHC-P, WB |
| Species Reactivity: | Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | O60885 |
| Alternative Name: | Brd4 antibody/BRD4-NUT FUSION antibody/BRD4-NUT fusion oncoprotein antibody |
| Scientific Background: | Plays a role in a process governing chromosomal dynamics during mitosis. |
| Product Types | ||
| ◆ Synthetic Peptides | ||
| SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
| SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
| SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
| SP-0004 | Bromodomain Ligand 3 | Inquiry |
| SP-0006 | Bromodomain Ligand 4 | Inquiry |
| Related Gene / Proteins | |||
| BRCA1 | BRCA2 | BRCC3 | BRD |
| brd1 | brd2 | brd3 | brd4 |
| BRD7 | BRD8 | brd9 | brdt |
| BRL | BRM | BRMS1 | BRPF1 |
| BRPF2 | brpf3 | BRWD1 | BRWD3 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools