WDR5 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2406
Product Overview:  Rabbit polyclonal to detect WDR5
Antibody Type:  Polyclonal
Immunogen:  Synthetic peptide within Human WDR5 aa 50-100.
Immunogen Sequence:  SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS N
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  0.09% Sodium azide, 99% Tris buffered saline, 0.1% BSA
Applications:  IHC-P, ICC/IF
Species Reactivity:  Mouse, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  NP_060058.1; P61964
Alternative Name:  2410008O07Rik antibody/AA408785 antibody/AA960360 antibody
Scientific Background:  Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.
Product Types
◆ Antibodies
EAb-0005 WDR5 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0052 Recombinant Human WDTC1 293 Cell Lysate Inquiry
◆ Bioactive Small Molecules
BSM-0187 OICR-9429 Inquiry
BSM-0256 WDR5 0103 Inquiry
BSM-0335 MM-102 Inquiry
Related Gene / Proteins
WDHD1 WDR4 WDR5 WDR77
WDR82 WDTC1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart